Vesicle-associated membrane protein 2

UniProt : P63045, UniProt ID: VAMP2_RAT,

Vesicle-associated membrane protein 2

Rattus norvegicus

MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
SELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Vesicle-associated membrane protein 2 contains a PF00957 domain.

Vesicle-associated membrane protein 2 is proteolytically cut by bontoxilysin (M27.002) cleavage. RDQK-LSEL.

Vesicle-associated membrane protein 2 is proteolytically cut by bontoxilysin (M27.002) cleavage. GASQ-FETS.

Vesicle-associated membrane protein 2 is proteolytically cut by bontoxilysin (M27.002) cleavage. ERDQ-KLSE.

Vesicle-associated membrane protein 2 is proteolytically cut by bontoxilysin (M27.002) cleavage. ETSA-AKLK.