cDNA FLJ76954, highly similar to Homo sapiens high-glucose-regulated protein 8, mRNA (YTH domain family, member 2, isoform CRA_a)

UniProt : A8K966, Q9Y5A9, UniProt ID: A8K966_HUMAN, YTHD2_HUMAN,

cDNA FLJ76954, highly similar to Homo sapiens high-glucose-regulated protein 8, mRNA (YTH domain family, member 2, isoform CRA_a)

Homo sapiens

MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYY
SPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQH
GFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAP
GMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWA
DIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPT
QGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSG
FGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYN
TCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQV
LKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76954, highly similar to Homo sapiens high-glucose-regulated protein 8, mRNA (YTH domain family, member 2, isoform CRA_a) contains a PF04146 domain.

cDNA FLJ76954, highly similar to Homo sapiens high-glucose-regulated protein 8, mRNA (YTH domain family, member 2, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. NGVD-GNGV.

cDNA FLJ76954, highly similar to Homo sapiens high-glucose-regulated protein 8, mRNA (YTH domain family, member 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. AMID-GQSA.