Zinc finger protein 24

UniProt : P17028, UniProt ID: ZNF24_HUMAN,

Zinc finger protein 24

Homo sapiens

MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Zinc finger protein 24 contains a PF00096 domain.

Zinc finger protein 24 contains a PF00096 domain.

Zinc finger protein 24 contains a PF00096 domain.

Zinc finger protein 24 contains a PF00096 domain.

Zinc finger protein 24 contains a PF02023 domain.

Zinc finger protein 24 is proteolytically cut by caspase () cleavage. VEED-SILI.