Putative RNA-binding protein Luc7-like 2

UniProt : Q9Y383, UniProt ID: LC7L2_HUMAN,

Putative RNA-binding protein Luc7-like 2

Homo sapiens

MSAQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECL
KVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVA
AKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPAS
SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRN
QERLKRREEREREEREKLRRSRSHSKNPKRSRSREHRRHRSRSMSRERKRRTRSKSREKR
HRHRSRSSSRSRSRSHQRSRHSSRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPR
DRDRKDKKRSYESANGRSEDRRSSEEREAGEI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative RNA-binding protein Luc7-like 2 contains a PF03194 domain.

Putative RNA-binding protein Luc7-like 2 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AMLD-QLMG.