Vesicle-associated membrane protein 1

UniProt : P23763, UniProt ID: VAMP1_HUMAN,

Vesicle-associated membrane protein 1

Homo sapiens

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Vesicle-associated membrane protein 1 contains a PF00957 domain.

Vesicle-associated membrane protein 1 is proteolytically cut by IgA1-specific metallopeptidase (M26.001) cleavage. GASQ-FESS.