Vesicle-associated membrane protein 1
UniProt : P23763, UniProt ID: VAMP1_HUMAN, Vesicle-associated membrane protein 1 Homo sapiens MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Vesicle-associated membrane protein 1 contains a PF00957 domain.
Vesicle-associated membrane protein 1 is proteolytically cut by IgA1-specific metallopeptidase (M26.001) cleavage. GASQ-FESS.