Eukaryotic translation initiation factor 4E-binding protein 1

UniProt : Q62622, UniProt ID: 4EBP1_RAT,

Eukaryotic translation initiation factor 4E-binding protein 1

Rattus norvegicus

MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Eukaryotic translation initiation factor 4E-binding protein 1 contains a PF05456 domain.

Eukaryotic translation initiation factor 4E-binding protein 1 is proteolytically cut by chymotrypsin () cleavage. PGDY-STTP.

Eukaryotic translation initiation factor 4E-binding protein 1 is proteolytically cut by chymotrypsin () cleavage. GTLF-STTP.

Eukaryotic translation initiation factor 4E-binding protein 1 is proteolytically cut by lysyl endopeptidase () cleavage. YDRK-FLME.

Eukaryotic translation initiation factor 4E-binding protein 1 is proteolytically cut by lysyl endopeptidase () cleavage. PVAK-TPPK.

Eukaryotic translation initiation factor 4E-binding protein 1 is proteolytically cut by lysyl endopeptidase () cleavage. TPPK-DLPT.