Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a)

UniProt : A8MT35, P30519, UniProt ID: A8MT35_HUMAN, HMOX2_HUMAN,

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a)

Homo sapiens

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF01352 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) contains a PF00096 domain.

Putative uncharacterized protein HMOX2 (Heme oxygenase (Decycling) 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. TLED-GFPV.