cDNA FLJ78245, highly similar to Homo sapiens mannose-6-phosphate receptor binding protein 1 (M6PRBP1), mRNA

UniProt : A8K4Y9, O60664, UniProt ID: A8K4Y9_HUMAN, M6PBP_HUMAN,

cDNA FLJ78245, highly similar to Homo sapiens mannose-6-phosphate receptor binding protein 1 (M6PRBP1), mRNA

Homo sapiens

MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVC
DAAEKGVRTLTAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLAD
TKELVSSKVSGAQEMVSSAKDTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSR
LGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQSYFVRLG
SLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLMETVKQGVDQKLVEGQEKLHQM
WLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQ
QARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP
FAPGITEKAPEEKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78245, highly similar to Homo sapiens mannose-6-phosphate receptor binding protein 1 (M6PRBP1), mRNA contains a PF03036 domain.

cDNA FLJ78245, highly similar to Homo sapiens mannose-6-phosphate receptor binding protein 1 (M6PRBP1), mRNA is proteolytically cut by caspase () cleavage. TSLD-GFDV.

cDNA FLJ78245, highly similar to Homo sapiens mannose-6-phosphate receptor binding protein 1 (M6PRBP1), mRNA is proteolytically cut by caspase () cleavage. AEAD-GSTQ.