cDNA FLJ75690, highly similar to Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA

UniProt : A8K5L8, O95817, UniProt ID: A8K5L8_HUMAN, BAG3_HUMAN,

cDNA FLJ75690, highly similar to Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA

Homo sapiens

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ
RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY
QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE
KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR
RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG
NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ75690, highly similar to Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA contains a PF00397 domain.

cDNA FLJ75690, highly similar to Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA contains a PF02179 domain.

cDNA FLJ75690, highly similar to Homo sapiens BCL2-associated athanogene 3 (BAG3), mRNA is proteolytically cut by () cleavage..