Enhanced at puberty protein 1

UniProt : Q8K3X4, UniProt ID: EAP1_MOUSE,

Enhanced at puberty protein 1

Mus musculus

MSAAQVSSSRRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRA
HGCFQDGRSPGPPPPVGVKTVALSAKEAAAAAAAAQQQQQQQQQQQQQLNHVDGSTKPAV
LAAPSGLERYGLSAAAAAAAAAAAVEQRSRFEYPPPPVSLGSSSHAARLPNGLGGPNGFP
KPAPEEGPPELNRQSPNSSSAATSVASRRGTHSGLVTGLPNPGGGGGPQLTVPPNLLPQT
LLNGPASAAVLPPPHGLGGSRGPPTPAPPGAPGGPACLGGPPGVSATVSSAPSSTSSTVA
EVGVGAAGKRPGSVSSTDQERELKEKQRNAEALAELSESLRNRAEEWANKPKMVRDTLLT
LAGCTPYEVRFKKDHSLLGRVFAFDAVSKPGMDYELKLFIEYPTGSGNVYSSASGVAKQM
YQDCMKDFGRGLSSGFKYLEYEKKHGSGDWRLLGDLLPEAVRFFKEGVPGADMLPQPYLD
ASCPMLPTALVSLSRAPSAPPGTGALPPAAPTGRGAASSLRKRKASPEPPDSAESALKLG
EEQQRQQWMANQSEALKLTMSAGGFAAPGHSAGGPPPPPPPLGPHSNRTTPPESAPQNGP
SPMAALMSVADTLGTAHSPKDGSSVHSTTASARRNSSSPVSPASVPGQRRLASRNGDLNL
QVAPPPPSAHPGMDQVHPQNIPDSPMANSGPLCCTICHERLEDTHFVQCPSVPSHKFCFP
CSRESIKAQGATGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Enhanced at puberty protein 1 is proteolytically cut by caspase-1 (C14.001) cleavage. VDGS-TKPA.