cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA

UniProt : B2RBC5, O60508, UniProt ID: B2RBC5_HUMAN, PRP17_HUMAN,

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA

Homo sapiens

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEV
AVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHI
NDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKK
FKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLS
GHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWD
TETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTT
KLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA contains a PF00400 domain.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA is proteolytically cut by caspase () cleavage. SNID-GFLG.

cDNA, FLJ95438, Homo sapiens cell division cycle 40 homolog (yeast) (CDC40), mRNA is proteolytically cut by caspase () cleavage. DEKD-VAKP.