P348

UniProt : Q9Q703, UniProt ID: Q9Q703_9CLOS,

P348

Beet yellows virus

MAFLNVSAVPSCAFAPAFAPHAGASPIVPDSFPCVPRYSDDISHFRLTLSLDFSVPRPLF
LNARVHLRASTDNPLPSLPLGFHAETFVLELNGSSAPFSIPSRHIDFVVNRPFSVFPTEV
LSVSSLRTPSRLFALLCDFFLYCSKPGPCVEIASFSTPPPCLVSNCVAQIPTHAEMESIR
FPTKTLPAGRLLQFHKRKYTKRPETLIIHESGLALKTSALGVTSKPNSRPITVKSASGEK
YEAYEISRKDFERSRRRQQTPRVRSHKPRKINKAVEPFFFPEEPKKDKRKRASLPTKDEG
FITFGTLRFPLSETPKEEPRLPKFREVEIPVVKKHAVPAVVSKPVRTFRPVATTGAEYVN
ARTQCSRRPRNHPILRSASYTFGFKKMPLQRFMKEKKDYYVKRSKVVSSCSVTKSPLEAL
TSILKNLPRYSYNSERLKFYDHFIGDDFEIEVHPLRGGKLSVLLILPKGEAYCVVTAATP
QYHAALTIARGDRPRVGELLQYRPGEGLCYLAHAALCCALQKRTFREEDFFVGMYPTKFV
FAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAFSSPFYSLPRFIGGVEEEAPEITSS
LKHKAIESVYERVSIHKDNLLARSVEKDLIDFKDEIKSLSKEKRSVTVPFYMGEAVQSGL
TRAYPQFNLSFTHSVYSDHPAAAGSRLLENETLASMAKSSFSDIGGCPLFHIKRGSTDYH
VCRPIYDMKDAQRRVSRELQARGLVENLSREQLVEAQARVSVCPHTLGNCNVKSDVLIMV
QVYDASLNEIASAMVLKESKVAYLTMVTPGELLDEREAFAIDALGCDVVVDTRRDMVQYK
FGSSCYCHKLSNIKNIMLTPAFTFSGNLFSVEMYENRMGVNYYKITRSAYSPEIRGVKTL
RYRRACTEVVQVKLPRFDKTLKTFLSGYDYIYLDAKFVSRVFDYVVSNCSVVNSKTFEWV
WSYIKSSKSRVVISGKVIHRDVHIDLKHSECFAAVMLAVGVRSRTTTEFLAKNLNYYTGD
ASCFETIRFLFREWSRRAYAEINRSFRKLMKSILSAGLDYEFLDLDNSLQHLLEYSEVEV
RVSIAQNGEVDCNEENRVLTEIIAEAADRKSIAQGLSGALSSVPTQPRGGLRGGSRRSGV
SFLYNLVEEVGNLFFSVGDAVRFLVKVFKTFSDSPIFRVVRMFLDLAEAASPFVSVVSLC
AWLREAVSAFSSWVADRTVSESVKTFVNRTVKRFLNFMSAKTLTKKFFRFFLSASALAKT
VVRKAKVILEAYWEVWFESILSDSGEYSAVEFCSSVVITLLTNSGRLLPGFSPSAVITEV
LLDLATKISIEVLLKQISPVDSTASSALYRRVLSEILSNFRTMGEHGIFTKVFLLCGFLP
VFVRKCVALCVPGDMATYARFLEYGVDDLFFLGRSVNSIKNYLCVVAAGLVDSIVDSVVL
KLSGVAKERVLGFKSKIIKNFLNVFRKAKVVTRTSSSTDLSEDEYFSCDESKPGLRGGSS
RFTLSRLLDIFFNFLKSSKLVIENACFSAYERIERNMKLYFFPLNSSEEEARRLIRCAGD
FDYLSDSAFDEDEMLRQAFEQYYSSDDESVTYDGKPTVLRSYLNVSRRFLETFCNGPKFF
VKVSNYFKALYSRLLRVLPWVDRNLSDSPGLKGGNEKALLAKFLKTCVITACECVSQICC
LRLIRLCWGTPACGLVRLFYITYSGTRVLSRVVVAVAVCPLLVRNELDGLSDGLTNMGVS
VFRRLFVALRRALSAYSNSALRRKIFEFIFGNIHHPFDVAVIETNEVAPEPLSPEVDIDV
DCDFGSDSESVSSDEVASIPRPGLHGGSRRSSNFLTSLVKVVFKLAGRIPRLLFRLRNFV
AYFVERRLASKRLKTFIGLARLFDNFSLTSVVYLLQEYDSVLNAFIDVELVLLNSGSVNV
LPLVSWVRGSLTKLAEVIVGSGFASFLGRMCCRVSDWCSSSSNAGCNFMSPVRTKGKFVP
PSSSGSTASMYERLEALESDIREHVLSTCRVGSDEEEERPKEVTEPGIEHTSEDVVPIRS
HSQPLSGGECSYSEDREENERANLLPHVSKIVSERRGLETARRNKRTLRGVSEFLNAINT
SNEQPRPIIVDHSPESRALTNSVREFYYLQELALFELSCKLREYYDQLKVANFNRQECLC
DKDEDMFVLRAGQGVVSGRNSRLPLKHFKGHEFCFRSGGLVPYDGTSRVDTIFHTQTNFV
SANALLSGYLSYRTFTFTNLSANVLLYEAPPGGGKTTTLIKVFCETFSKVNSLILTANKS
SREEILAKVNRIVLDEGDTPLQTRDRILTIDSYLMNNRGLTCKVLYLDECFMVHAGAAVA
CIEFTKCDSAILFGDSRQIHYIDRNELDTAVLSDLNRFVDDESRVYGEVSYRCPWDVCAW
LSTFYPKTVATTNLVSAGQSSMQVREIESVDDVEYSSEFVYLTMLQSEKKDLLKSFGKRS
RSSVEKPTVLTVHEAQGETYRKVNLVRTKFQEDDPFRSENHITVALSRHVESLTYSVLSS
KRDDAIAQAIVKAKQLVDAYRVYPTSFGGSTLDISVNPSTSDRSKCKASSAPYEVINSFL
ESVVPGTTSVDFGDVSEEMGTQVFESGADNVVIRDSAPVNKSTDHDPQRVSSIRSQAIPK
RKPSLQENLYSYESRNYNFTVCERFSGPQEFGQAMAMVMLERSFDLEKVAKVRSDVIAIT
EKGVRTWMSKREPSQLRALSSDLQKPLNLEEEITTFKLMVKRDAKVKLDSSCLVKHPPAQ
NIMFHRKAVNAIFSPCFDEFKNRVITCTNSNIVFFTEMTNSTLASIAKEMLGSEHVYNVG
EIDFSKFDKSQDAFIKSFERTLYSAFGFDEDLLDVWMQGEYTSNATTLDGQLSFSVDNQR
KSGASNTWIGNSIVTLGILSMFYYTNRFKALFVSGDDSLIFSESPIRNSADAMCTELGFE
TKFLTPSVPYFCSKFFVMTGHDVFFVPDPYKLLVKLGASKDEVDDEFLFEVFTSFRDLTK
DLVDERVIELLTHLVHSKYGYESGDTYAALCAIHCIRSNFSSFKKLYPKVKGWVVHYGKL
KFVLRKFANCFREKFDTAFGEAYFLTYDET

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

P348 contains a PF00978 domain.

P348 contains a PF01443 domain.

P348 contains a PF01660 domain.

P348 contains a PF05533 domain.

P348 is proteolytically cut by beet yellows virus-type papain-like peptidase (C42.001) cleavage. RFIG-GVEE.