Vitamin K-dependent protein S

UniProt : P07224, UniProt ID: PROS_BOVIN,

Vitamin K-dependent protein S

Bos taurus

MRVLGGRTGTLLACLALVLPVLEANFLSRQHASQVLIRRRRANTLLEETKKGNLERECIE
ELCNKEEAREIFENNPETEYFYPKYLGCLGSFRAGLFTAARLSTNAYPDLRSCVNAISDQ
CNPLPCNEDGFMTCKDGQATFTCICKSGWQGEKCESDINECKDPVNINGGCSQICENTPG
SYHCSCKNGFVMLSNKKDCKDVDECVLKPSICGTAVCKNIPGDFECECAEGYKYNPVSKS
CDDVDECAENLCAQLCVNYPGGYSCYCDGKKGFKLAQDQKSCEAVPVCLPLDLDKNYELL
YLAEQFVGVVLYLKFRLPETTRFSAEFDFRTYDSEGVILYAESSDHSAWFLIALREGKIE
IQFKNEKTTKMTTGGKVINDGLWHMVSVEELEQSISVKIAKEAVMNINKPGSLFKPTNGF
LETKVYFAGVPRKMENALIRPINPRLDGCIRGWNLMNQGTSGVKEIIQEKQNKHCLVNVE
KGSYYPGTGVAQFSINYKNESNPEAWQINVSLNIRPSAGTGVMLALVSDNTVPFALSLVD
SATEKLQDILVSVESMVIGRIEAISLCSDQQTFLEIRVNRNNLELSTQLRKDSFHSEDFQ
RQFAILDEAMKGTVVTYLGGLPDVPFSATPVNAFYQGCMEVNINGVQVDLDEAISKHNDI
RAHSCPSVWQKTKHT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Vitamin K-dependent protein S contains a PF02210 domain.

Vitamin K-dependent protein S contains a PF07645 domain.

Vitamin K-dependent protein S contains a PF00594 domain.

Vitamin K-dependent protein S contains a PF00008 domain.

Vitamin K-dependent protein S contains a PF00008 domain.

Vitamin K-dependent protein S is proteolytically cut by thrombin (S01.217) cleavage. GSFR-AGLF.

Vitamin K-dependent protein S is proteolytically cut by thrombin (S01.217) cleavage. PDLR-SCVN.