Beta-defensin 1

UniProt : P60022, UniProt ID: DEFB1_HUMAN,

Beta-defensin 1

Homo sapiens

MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
RGKAKCCK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta-defensin 1 contains a PF00711 domain.

Beta-defensin 1 is proteolytically cut by mirabilysin (M10.057) cleavage..

Beta-defensin 1 is proteolytically cut by ZapA () cleavage..