CvaC

UniProt : P22522, Q5DQJ0, UniProt ID: CEAV_ECOLX, Q5DQJ0_ECOLX,

CvaC

Escherichia coli

MRTLTLNELDSVSGGASGRDIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNP
AMSPSGLGGTIKQKPEGIPSEAWNYAAGRLCNWSPNNLSDVCL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CvaC is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. VSGG-ASGR.