cDNA FLJ78077, highly similar to H.sapiens protease inhibitor 12 (PI12; neuroserpin) (Serpin peptidase inhibitor, clade I (Neuroserpin), member 1, isoform CRA_a)

UniProt : A8K217, Q99574, UniProt ID: A8K217_HUMAN, NEUS_HUMAN,

cDNA FLJ78077, highly similar to H.sapiens protease inhibitor 12 (PI12; neuroserpin) (Serpin peptidase inhibitor, clade I (Neuroserpin), member 1, isoform CRA_a)

Homo sapiens

MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMM
ELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHV
NEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLAL
INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQ
VLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQE
IDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAI
SRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78077, highly similar to H.sapiens protease inhibitor 12 (PI12; neuroserpin) (Serpin peptidase inhibitor, clade I (Neuroserpin), member 1, isoform CRA_a) contains a PF00079 domain.

cDNA FLJ78077, highly similar to H.sapiens protease inhibitor 12 (PI12; neuroserpin) (Serpin peptidase inhibitor, clade I (Neuroserpin), member 1, isoform CRA_a) is proteolytically cut by t-plasminogen activator (S01.232) cleavage. AISR-MAVL.