Defensin, alpha 3, neutrophil-specific

UniProt : P59666, Q6EZE9, UniProt ID: DEF3_HUMAN, Q6EZE9_HUMAN,

Defensin, alpha 3, neutrophil-specific

Homo sapiens

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Defensin, alpha 3, neutrophil-specific contains a PF00323 domain.

Defensin, alpha 3, neutrophil-specific contains a PF00879 domain.

Defensin, alpha 3, neutrophil-specific is proteolytically cut by () cleavage. QAQA-EPLQ.

Defensin, alpha 3, neutrophil-specific is proteolytically cut by () cleavage. QIAA-DIPE.

Defensin, alpha 3, neutrophil-specific is proteolytically cut by () cleavage. RKNM-DCYC.