Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence)

UniProt : P59665, Q6EZF6, UniProt ID: DEF1_HUMAN, Q6EZF6_HUMAN,

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence)

Homo sapiens

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence) contains a PF00323 domain.

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence) contains a PF00879 domain.

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence) is proteolytically cut by () cleavage. QAQA-EPLQ.

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence) is proteolytically cut by () cleavage. QIAA-DIPE.

Novel protein, similar to DEFA1 (Defensin, alpha 1, preproprotein) (Defensin, alpha 1) (Defensin, alpha 1, myeloid-related sequence) is proteolytically cut by () cleavage. RKNM-ACYC.