Defensin, alpha 5, Paneth cell-specific

UniProt : A0JDY6, Q01523, UniProt ID: A0JDY6_HUMAN, DEF5_HUMAN,

Defensin, alpha 5, Paneth cell-specific

Homo sapiens

MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQ
ARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Defensin, alpha 5, Paneth cell-specific contains a PF00879 domain.

Defensin, alpha 5, Paneth cell-specific contains a PF00323 domain.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by trypsin (S01.127) cleavage. SALR-TSGS.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by trypsin (S01.127) cleavage. SALR-TSGS.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by trypsin () cleavage. SQAR-ATCY.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by () cleavage. SALR-TSGS.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by () cleavage. QAQA-ESLQ.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by () cleavage. AESL-QERA.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by () cleavage. RADE-ATTQ.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by paneth cell trypsin () cleavage. QAQA-ESLQ.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by paneth cell trypsin () cleavage. AESL-QERA.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by paneth cell trypsin () cleavage. RADE-ATTQ.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by paneth cell trypsin () cleavage. SALR-TSGS.

Defensin, alpha 5, Paneth cell-specific is proteolytically cut by paneth cell trypsin () cleavage. SQAR-ATCY.