130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein

UniProt : Q9QWY8, UniProt ID: DDEF1_MOUSE,

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein

Mus musculus

MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
PKEVGGLYVASRANSSRRDSQSRQGGYSMHQLQGNKEYGSEKKGFLLKKSDGIRKVWQRR
KCAVKNGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYI
AWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWL
STNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPS
PSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCASSSAKLNELLEAIKSRDLLALIQVYAE
GVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTSVGNTVLHYCS
MYGKPECLKLLLRSKPTVDIVNQNGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEY
EWNLRQDEMDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRL
SYGAFTNQIFASTSTDLPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGTQTSSGSSTLSKK
RPPPPPPGHKRTLSDPPSPLPHGPPNKGAIPWGNDVGPSSSSKTANKFEGLSQQASTSSA
KTALGPRVLPKLPQKVALRKTETSHHLSLDRTNIPPETFQKSSQLTELPQKPPLGELPPK
PVELAPKPQVGELPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKS
QAGDVSAKVQPPSEVTQRSHTGDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKI
NTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVS
FVHILSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF00018 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF00023 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF00023 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF00023 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF00169 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein contains a PF01412 domain.

130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein is proteolytically cut by calpain-2 (C02.002) cleavage..