Sodium/potassium ATPase inhibitor SPAI-2

UniProt : P16225, UniProt ID: SPAI_PIG,

Sodium/potassium ATPase inhibitor SPAI-2

Sus scrofa

MRSRSFLVLVAVFLICETLVAQRLDRIRGPKGQGQDPVEGQDQDEGPGPVKVEILDIGQD
PVKGQDPVKGQDPVKGQDPVKGQDLVKSQDPVKAELPDIGQDVVKGHEPVEGQDPVNAQL
PDKVQDPVKAQPAVPGRFLLSKRGHCPRILFRCPLSNPSNKCWRDYDCPGVKKCCEGFCG
KDCLYPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sodium/potassium ATPase inhibitor SPAI-2 contains a PF00095 domain.

Sodium/potassium ATPase inhibitor SPAI-2 is proteolytically cut by () cleavage. KVQD-PVKA.

Sodium/potassium ATPase inhibitor SPAI-2 is proteolytically cut by () cleavage. TLVA-QRLD.