PMAP: SubstrateDB : Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2)

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2)

UniProt : P55085, Q53XJ8, UniProt ID: PAR2_HUMAN, Q53XJ8_HUMAN,

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2)

Homo sapiens

MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) contains a PF00001 domain.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by trypsin 1 (S01.151) cleavage. SKGR-SLIG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by gingipain R (C25.001) cleavage..

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by gingipain K (C25.002) cleavage..

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by tryptase alpha (S01.143) cleavage. SKGR-SLIG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by tryptase alpha (S01.143) cleavage. LIGK-VDGT.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by trypsin 1 (S01.151) cleavage. IGKV-DGTS.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by trypsin 1 (S01.151) cleavage. VTGK-GVTV.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. SKGR-SLIG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VTGK-GVTV.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. GTNR-SSKG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. LIGK-VDGT.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. SKGR-SLIG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. GTNR-SSKG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK6 (S01.236) cleavage. SKGR-SLIG.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK6 (S01.236) cleavage. LIGK-VDGT.

Coagulation factor II (Thrombin) receptor-like 1 (Protease-activated receptor 2) is proteolytically cut by kallikrein hK6 (S01.236) cleavage. VTGK-GVTV.