PRELP protein (Proline/arginine-rich end leucine-rich repeat protein)

UniProt : P51888, Q6FG38, UniProt ID: PRELP_HUMAN, Q6FG38_HUMAN,

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein)

Homo sapiens

MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPP
PLPPGPPSIFPDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVE
SFQNATGLRWINLDNNRIRKIDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQ
NHISRIPPGVFSKLENLLLLDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRV
PTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN
YLKPPIPLDLMMCFRLLQSVVI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF00560 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) contains a PF01462 domain.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DLVA-FHDF.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. HLRY-LRLD.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LLLD-LQHN.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. KPDT-FHGL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GLKN-LMQL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. PHLR-YLRL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. LVAF-HDFS.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LYLD-SNKI.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. PNGY-FKSF.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LYME-KNQL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LEQL-RLSQ.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. VAFH-DFSS.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. SDLE-NVPH.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. VAFH-DFSS.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LRYL-RLDG.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. IRKI-DQRV.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. PGLV-FLYM.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. YMEK-NQLE.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. IDQR-VLEK.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. YLRL-DGNY.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LDLM-MCFR.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LLLL-DLQH.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. DGVF-KPDT.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. QLYL-DSNK.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. FLYM-EKNQ.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. YFKS-FPNL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. FIRL-NYNK.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. VFLY-MEKN.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LVFL-YMEK.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NLEQ-LRLS.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LVFL-YMEK.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LPRN-LEQL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. VLHL-SHNR.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RLEH-LYLN.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. HISR-IPPG.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KLEN-LLLL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LPRN-LEQL.

PRELP protein (Proline/arginine-rich end leucine-rich repeat protein) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LSQN-HISR.