Proteinase-activated receptor 2

UniProt : Q63645, UniProt ID: PAR2_RAT,

Proteinase-activated receptor 2

Rattus norvegicus

MRSLSLAWLLGGITLLAASASCNRTVNAPGPNSKGRSLIGRLDTPPPITGKGAPVEPGFS
VDEFSASVLTGKLTTVFLPVIYIIVFVIGLPSNGMALWVFFFRTKKKHPAVIYMANLALA
DLLSVIWFPLKISYHLHGNDWTYGDALCKVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKRANIAVGVSLAIWLLIFLVTIPLYVMRQTIYIPALNITTCHDVLPEEVLVGDMF
SYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDEHSEKKRRRAIRLIITVLSMYFICF
APSNVLLVVHYFLIKSQRQSHVYALYLVALCLSTLNSCIDPFVYYFVSKDFRDQARNALL
CRSVRTVKRMQISLTSNKFSRKSSSYSSSSTSVKTSY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proteinase-activated receptor 2 contains a PF00001 domain.

Proteinase-activated receptor 2 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PNSK-GRSL.