Phosphoprotein enriched in astrocytes 15 (Phosphoprotein enriched in astrocytes 15, isoform CRA_a) (cDNA, FLJ92023, Homo sapiens phosphoprotein enriched in astrocytes 15 (PEA15),mRNA)

UniProt : B1AKZ4, Q15121, UniProt ID: B1AKZ4_HUMAN, PEA15_HUMAN,

Phosphoprotein enriched in astrocytes 15 (Phosphoprotein enriched in astrocytes 15, isoform CRA_a) (cDNA, FLJ92023, Homo sapiens phosphoprotein enriched in astrocytes 15 (PEA15),mRNA)

Homo sapiens

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Phosphoprotein enriched in astrocytes 15 (Phosphoprotein enriched in astrocytes 15, isoform CRA_a) (cDNA, FLJ92023, Homo sapiens phosphoprotein enriched in astrocytes 15 (PEA15),mRNA) contains a PF01335 domain.

Phosphoprotein enriched in astrocytes 15 (Phosphoprotein enriched in astrocytes 15, isoform CRA_a) (cDNA, FLJ92023, Homo sapiens phosphoprotein enriched in astrocytes 15 (PEA15),mRNA) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..