Chromogranin A (Parathyroid secretory protein 1) (Chromogranin A (Parathyroid secretory protein 1), isoform CRA_a)

UniProt : Q6NR84, UniProt ID: Q6NR84_HUMAN,

Chromogranin A (Parathyroid secretory protein 1) (Chromogranin A (Parathyroid secretory protein 1), isoform CRA_a)

Homo sapiens

MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETL
RGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEA
VEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEA
TNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAG
EEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHS
QQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEG
QEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKE
EEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chromogranin A (Parathyroid secretory protein 1) (Chromogranin A (Parathyroid secretory protein 1), isoform CRA_a) contains a PF01271 domain.

Chromogranin A (Parathyroid secretory protein 1) (Chromogranin A (Parathyroid secretory protein 1), isoform CRA_a) is proteolytically cut by plasmin (S01.233) cleavage. LSFR-ARAY.

Chromogranin A (Parathyroid secretory protein 1) (Chromogranin A (Parathyroid secretory protein 1), isoform CRA_a) is proteolytically cut by plasmin (S01.233) cleavage. PQLR-RGWR.