A disintegrin and metallopeptidase domain 17

UniProt : Q505A7, UniProt ID: Q505A7_MOUSE,

A disintegrin and metallopeptidase domain 17

Mus musculus

MRRRLLILTTLVPFVLAPRPPEEAGSGSHPRLEKLDSLLSDYDILSLANIQQHSIRKRDL
QSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQNFFSGHVV
GEPDSRVLAHIGDDDVTVRINTDGAEYNVEPLWRFVNDTKDKRMLVYKSEDIKDFSRLQS
PKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNM
AKSFPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYNPTVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACVDTDNSC
KVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHHSNIEMLSSMD
SASVRIIKPFPAPQTPGRLQALQPAAMMPPVPAAPKLDHQRMDTIQEDPSTDSHADDDGF
EKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQSRVDSKETEC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

A disintegrin and metallopeptidase domain 17 contains a PF00200 domain.

A disintegrin and metallopeptidase domain 17 contains a PF01421 domain.

A disintegrin and metallopeptidase domain 17 is proteolytically cut by furin (S08.071) cleavage. FVRR-VKRR.

A disintegrin and metallopeptidase domain 17 is proteolytically cut by furin (S08.071) cleavage. RVKR-RAEP.