Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c)

UniProt : Q16849, Q53QD6, UniProt ID: PTPRN_HUMAN, Q53QD6_HUMAN,

Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c)

Homo sapiens

MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAEL
LPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEA
PALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQG
SSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTL
LTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSE
VQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKP
LSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c) contains a PF00102 domain.

Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c) is proteolytically cut by calpain-1 (C02.001) cleavage. SVSS-QFSD.

Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c) is proteolytically cut by calpain-1 (C02.001) cleavage. SVSS-QFSD.

Putative uncharacterized protein PTPRN (Protein tyrosine phosphatase, receptor type, N, isoform CRA_c) is proteolytically cut by calpain-1 (C02.001) cleavage. RQQD-KERL.