Tumor necrosis factor (Ligand) superfamily, member 11 (Tumor necrosis factor (Ligand) superfamily, member 11, isoform CRA_c)

UniProt : O14788, Q5T9Y4, UniProt ID: Q5T9Y4_HUMAN, TNF11_HUMAN,

Tumor necrosis factor (Ligand) superfamily, member 11 (Tumor necrosis factor (Ligand) superfamily, member 11, isoform CRA_c)

Homo sapiens

MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tumor necrosis factor (Ligand) superfamily, member 11 (Tumor necrosis factor (Ligand) superfamily, member 11, isoform CRA_c) contains a PF00229 domain.

Tumor necrosis factor (Ligand) superfamily, member 11 (Tumor necrosis factor (Ligand) superfamily, member 11, isoform CRA_c) is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. GSQH-IRAE.