P1 protein (Fragment)

UniProt : Q1G2C1, UniProt ID: Q1G2C1_9POTY,

P1 protein (Fragment)

Cucumber vein yellowing virus

MAEVYSFVPKTDYEKRMVKRFGTDKFLQFREQCPLSQVRKCWTHFKVCDGACYAYLLVHF
TEEGAREFLELSAGRRKLVLDNVRRALCSALYYNPNEEDFECECGNSNTSWKRVCEDCEQ
VYAYSEMNLLQELSKIAATLSSYINELKNFTIHDIADEVSYAEKSRRMTTVESGFKTVDE
ISLRTEVVEAVISEKPVESVTVKAVVAEKPVEASDNSRVAMEEKKPQTKQVWKMVTGKPK
PTVIPECKPEAPTKKEIQTCLDLVVQIGDFIINTRTREFKMVDEENECTEKVEETEVKEP
VVENPNKDTVVLNDFFKNFQFNEERRSKIYTDKHGNVRYGKRPMKKRKRGKKVELVSDKI
ITKIETPEEVQPVYSFEDLPSIKKAYSKKKPREIIKTRTEYSVRSLVKEIGKTCSFTEIM
IIDKKIRKIKKCGSRYFVDVRHLNGCNPEVDLDHSSFSDEILDWLMASLAVKSTKLSEIV
PGTSGLITVGRNEFGKFTIIRGWLDRIVDARENLTKSQLRRIRNYTIHGLHAFKKRYQTN
AIDRECTTQIQIKDNVVYLKGEGALQNFINSSILGGLVRNASGVTKPALACLRKATKYGV
GFDMMMNHYVCCRCHVRCTDISLMNTMCNECGENMFESVGHESPFVTLPINPFECDVHPA
VAEIMKEAWWRDGVEDWPIEKKYHSNGKEIYVEKQGQRAWRSEFQLRETSSSRESDLGFA
AADNGVCLCEANFAWLDMFPCITLNHIFGLDFDDDMDPEIRDIMTRDNAQRVFSTGRLVK
YADICPGWSGVVITEDAVQPEEWNKFAWYNGICVVQGKNRESGIIENAIIMKTADEKDKI
DFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

P1 protein (Fragment) contains a PF01577 domain.

P1 protein (Fragment) is proteolytically cut by P1 protein () cleavage..