Nerve growth factor receptor (TNFR superfamily, member 16)

UniProt : Q8CFT3, UniProt ID: Q8CFT3_MOUSE,

Nerve growth factor receptor (TNFR superfamily, member 16)

Mus musculus

MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDE
ETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQL
RECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Nerve growth factor receptor (TNFR superfamily, member 16) contains a PF00020 domain.

Nerve growth factor receptor (TNFR superfamily, member 16) contains a PF00020 domain.

Nerve growth factor receptor (TNFR superfamily, member 16) contains a PF00020 domain.

Nerve growth factor receptor (TNFR superfamily, member 16) contains a PF00020 domain.

Nerve growth factor receptor (TNFR superfamily, member 16) contains a PF00531 domain.

Nerve growth factor receptor (TNFR superfamily, member 16) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. MGSS-QPVV.