Tumor necrosis factor receptor superfamily member 16

UniProt : P07174, UniProt ID: TNR16_RAT,

Tumor necrosis factor receptor superfamily member 16

Rattus norvegicus

MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGA
NQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEET
GHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRE
CTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSS
QPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGE
KLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHL
AGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSEST
ATSPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tumor necrosis factor receptor superfamily member 16 contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 16 contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 16 contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 16 contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 16 contains a PF00531 domain.

Tumor necrosis factor receptor superfamily member 16 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. SSQP-VVTR.

Tumor necrosis factor receptor superfamily member 16 is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. PVVT-RGTT.

Tumor necrosis factor receptor superfamily member 16 is proteolytically cut by presenilin 1 (A22.001) cleavage..