Orf1 protein

UniProt : Q54913, UniProt ID: Q54913_STRPY,

Orf1 protein

Streptococcus pyogenes

MRRAENNKHSRYSIRKLSVGVTSIAIASLFLGKVAYAVDNGQQISLTQGNTANTSEKWHH
IGKDGLIPLGISLEAAKKDFIEEVEKSHLPQKQKETYKQKIDAETDKDKLLLTYHSEYSK
DIKNLPASTEPTTQPVEAPVQETQAPALDSMVTDDSTSVTTDSPEETPSTETPAPSIPAV
PEAPASSPESEKSSVAASSEETSSPETPAAPETPEEPAAPSPESEEPSVVASSEETPSPE
TPEAPETPALPETPAQPAESEESSVAATTSPSPSTPAESETQTPPAVTKDSDKPSSAAEK
SAASSLVSEQTVQQPTPKRSSDKKEEQEQPYSPNRSLSRQARGYESGKYLPSTGEKAQPL
FLATMTLMSLLGSLLVTKRQKETKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Orf1 protein contains a PF00746 domain.

Orf1 protein contains a PF04650 domain.

Orf1 protein is proteolytically cut by streptopain (C10.001) cleavage..