Syndecan

UniProt : P18827, Q546D3, UniProt ID: Q546D3_HUMAN, SDC1_HUMAN,

Syndecan

Homo sapiens

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
ATPRPRETTQLPTTHQASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
KPTKQEEFYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syndecan contains a PF01034 domain.

Syndecan is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. ASQG-LLDR.

Syndecan is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. RLLG-LFGE.

Syndecan is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. ASQG-LLDR.