Syndecan

UniProt : P18828, Q3V1F2, UniProt ID: Q3V1F2_MOUSE, SDC1_MOUSE,

Syndecan

Mus musculus

MRRAALWLWLCALALRLQPALPQIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQT
PSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEK
EVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPR
VEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGA
TGASQSLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGGAY
QKPTKQEEFYA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syndecan contains a PF01034 domain.

Syndecan is proteolytically cut by neutral protease Npr599 () cleavage. GSGD-DSDN.

Syndecan is proteolytically cut by immune inhibitor A (M06.001) cleavage. SGSG-TGAL.