Interleukin-1 beta

UniProt : P01584, UniProt ID: IL1B_HUMAN,

Interleukin-1 beta

Homo sapiens

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interleukin-1 beta contains a PF02394 domain.

Interleukin-1 beta contains a PF00340 domain.

Interleukin-1 beta is proteolytically cut by trepolisin (S08.024) cleavage..

Interleukin-1 beta is proteolytically cut by streptopain (C10.001) cleavage. AYVH-DAPV.

Interleukin-1 beta is proteolytically cut by trepolisin (S08.024) cleavage..

Interleukin-1 beta is proteolytically cut by streptopain (C10.001) cleavage. AYVH-DAPV.

Interleukin-1 beta is proteolytically cut by caspase-4 (C14.007) cleavage. YVHD-APVR.

Interleukin-1 beta is proteolytically cut by caspase-4 (C14.007) cleavage. FEAD-GPKQ.

Interleukin-1 beta is proteolytically cut by caspase-1 (C14.001) cleavage. FEAD-GPKQ.

Interleukin-1 beta is proteolytically cut by caspase-1 (C14.001) cleavage. YVHD-APVR.

Interleukin-1 beta is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPYE-LKAL.

Interleukin-1 beta is proteolytically cut by caspase-1 (C14.001) cleavage. YVHD-APVR.

Interleukin-1 beta is proteolytically cut by chymase (S01.140) cleavage. NEAY-VHDA.

Interleukin-1 beta is proteolytically cut by cathepsin G (S01.133) cleavage. NEAY-VHDA.

Interleukin-1 beta is proteolytically cut by pancreatic elastase (S01.153) cleavage. EEPI-FFDT.

Interleukin-1 beta is proteolytically cut by pancreatic elastase (S01.153) cleavage. NEAY-VHDA.

Interleukin-1 beta is proteolytically cut by neutrophil elastase (S01.131) cleavage. NEAY-VHDA.