Amelogenin

UniProt : Q9YHT5, UniProt ID: Q9YHT5_XENLA,

Amelogenin

Xenopus laevis

MRPLVMLTALIGAAFSLPLPPQPQHPGYVNFSYEILSPIKWYQSMMKNQYPNYGYEPVSG
WLQSPMIPVPPMMQQQQLPSQNAVPKLPSHHPLLIPQQPLVPVPVHHPLIPLTPQHTHQL
KPIYLFNSDGQYPTNTQLLEPSKPDHESQNGQPTFPLHPLPPLVEERPQEPWQEAGNDKQ
EELD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amelogenin contains a PF02948 domain.

Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. VSGW-LQSP.