Matrilysin
|
UniProt : P09237, UniProt ID: MMP7_HUMAN, Matrilysin Homo sapiens MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD PQNFKLSQDDIKGIQKLYGKRSNSRKK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Matrilysin contains a PF01471 domain.
Matrilysin contains a PF00413 domain.
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAG-YSLF.
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAE-YSLF.
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAG-YSLF.
Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAE-YSLF.
Matrilysin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVAE-YSLF.