Matrilysin

UniProt : P09237, UniProt ID: MMP7_HUMAN,

Matrilysin

Homo sapiens

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Matrilysin contains a PF01471 domain.

Matrilysin contains a PF00413 domain.

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAG-YSLF.

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAE-YSLF.

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAG-YSLF.

Matrilysin is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAE-YSLF.

Matrilysin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVAE-YSLF.