Kexin like processing protease (Subtilisin-like proprotein convertase)

UniProt : Q874F6, UniProt ID: Q874F6_ASPOR,

Kexin like processing protease (Subtilisin-like proprotein convertase)

Aspergillus oryzae

MRLSESATVAFGLFCAATASAHPRRSYETRDFFALHLDDSTSPDEIAQRLGARHEGQVGE
LTQHHTFSIPKENGADLDALLEHARIRKRSSRAEGRGMTLDKERDLSGILWSQKLAPKQR
LVKRAPPTNVASRGSVKEEDPVAAQAQKRIASSLGITDPIFGGQWHLYNTVQVGHDLNVS
DVWLEGITGKGVITAVVDDGLDMYSNDLKPNYFAEGSYDFNDHVPEPRPRLGDDRHGTRC
AGEIGAARNDVCGVGVAYDSQVAGIRILSAPIDDADEAAAINYGFQRNDIYSCSWGPPDD
GATMEAPGILIKRAMVNGIQNGRGGKGSIFVFAAGNGAGYDDNCNFDGYTNSIYSITVGA
IDREGKHPSYSESCSAQLVVAYSSGSSDAIHTTDVGTDKCYSLHGGTSAAGPLAAGTIAL
ALSARPELTWRDAQYLMIETAVPVHEDDGSWQTTKMGKKFSHDWGFGKVDAYSLVQLAKT
WELVKPQAWFHSPWLRVKHEIPQGDQGLASSYEITKDMMYQANIEKLEHVTVTMNVNHTR
RGDISVELRSPEGIVSHLSTARRSDNAKAGYEDWTFMTVAHWGESGVGKWTVIVKDTNVN
DHVGEFIDWRLNLWGLSIDGSSQPLHPMPDEHDDDHSIEDAIVVTTSVDPLPTKTEAPPV
PTDPVDRPVNAKPSAQPTTPSEAPAQETSEAPTPTKPSSTESPSTTTSADSFLPSFFPTF
GASKRTQAWIYAAISSIIVFCIGLGVYFHVQRRKRLRNDPRDDYDFEMIEDEDETQAMNG
RSGRTQRRGGELYNAFAGESDEEPLFSDDEDEPYRDHALSEDRERRGSTSGDHARS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kexin like processing protease (Subtilisin-like proprotein convertase) contains a PF00082 domain.

Kexin like processing protease (Subtilisin-like proprotein convertase) contains a PF01483 domain.

Kexin like processing protease (Subtilisin-like proprotein convertase) is proteolytically cut by kexin (S08.070) cleavage. LVKR-APPT.