Micronemal protein MIC2

UniProt : O00816, UniProt ID: O00816_TOXGO,

Micronemal protein MIC2

Toxoplasma gondii

MRLQREAVFGLMFACGMWMWPSEVAGGGWSIVDALRKRYDTSRGGDANGVDTSGVEDVIQ
SDSAIGAAEGCTNQLDICFLIDSSGSIGIQNFRLVKQFLHTFLMVLPIGPEEVNNAVVTY
STDVHLQWDLQSPNAVDKQLAAHAVLEMPYKKGSTNTSDGLKACKQILFTGSRPGREHVP
KLVIGMTDGESDSDFRTVRAAKEIRELGGIVTVLAVGHYVKHSECRSMCGCSGTSDDDSP
CPLYLRADWGQLATAIKPMLKEVCKTLPQDAICSDWSAWSPCSVSCGDGSQIRTRTEVSA
PQPGTPTCPDCPAPMGRTCVEQGGLEEIRECSAGVCAVDAGCGVWGEWSAWSASCGNATR
KRERTRYNDPPPQGAGRRCENQDPPVLQEQTEEATLAPCITIPPTPPEWAAWSDCTVTCG
GGNRHRVRNALPPGLGSQNGESDESLVSKLWPGTDLRQEEACNTSPCPINATCGQFEEWS
TCSVSCGGGLKTRSRNPWNEDQQHGGLSCEQQHPGGRTETVTCNPQACPVDERPGEWAEW
GECSVTCGDGVRERRRGKSLVEAKFGGRTIDQQNEALPEDLKIKNVEYEPCSYPACGASC
TYVWSDWNKCVCPMGYQARHAAVKFDYRNKPCDLPTFETKACSCGETNPVPSEGTTPGAP
GATGPEQPNQRPLPEGSDENETPTNEEGEQSKKESGSGIAGAIAGGVIGGLILLGAAGGA
SYHYYLSSSVGSPSAEIEYEADDGATKVVMEEEKETLVPVDDDSDMWME

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Micronemal protein MIC2 contains a PF00092 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 contains a PF00090 domain.

Micronemal protein MIC2 is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Micronemal protein MIC2 is proteolytically cut by aarA protein (S54.004) cleavage..

Micronemal protein MIC2 is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Micronemal protein MIC2 is proteolytically cut by aarA protein (S54.004) cleavage..

Micronemal protein MIC2 is proteolytically cut by Rhomboid-1 (S54.001) cleavage..