Kexin like processing protease (Putative uncharacterized protein)

UniProt : Q874F7, UniProt ID: Q874F7_EMENI,

Kexin like processing protease (Putative uncharacterized protein)

Emericella nidulans

MRLQGAAAALGLFCAATASLHPRRSYETRDYFALHLDASTSPSDIAARLGARHEGQVGEL
DGHHTFSLPRENGADLDALLEDLQIKRKLRRRDGDLGALDKRDKDLAGILWSQKLTPKQR
LVKRTPPPEKLARDPSSDGEEKEDVEAAQARSKLVSTLGIEDPIFTKQWHLFNTVQVGHD
LNVTGVWLEGITGKGATAAIVDDGLDMYSNDLSPNYFPEGSWDFNDHTAEPRPRLRDDRH
GTRCAGEVAAARNDVCGVGVAYDSRIAGIRILSGPIDDTDEASAINYAYQENDIYSCSWG
PPDDGATMDAPGILVSRAIVNGVQKGRDGKGSIFVFAAGNGAASGDNCNFDGYTNSIYSI
TVGAIDREGQHPQYSESCSAQLVVAYSSGISDAISTTDVGTDRCYSVHGGTSAAGPLVVG
AISLALSVRPELTWRDAQYIVLETAVPVHEDDGSWQVTKSGRKFSHDWGYGKIDVYSLVQ
KAKTWELVKPQAWYHSPWLRVQHEVPQGDKGVAASWEVTEQMMKDANLEKLEHVTVTMNV
NHTRRGDLSVELRSPEGIVSHLSTPRKNDNAEVGYIDWTFMTVAHWGESGVGTWTVIVKD
STVNDNVGEFIDWRLNLWGMAVDGAKQKLHPLPDEHDDDHSIEDAIVVTTSVQPAPTATE
APVEPSHTVDRPVKVKPTSTGSASETETPTPTPTPASDSFLPSFFPTFGASKHTQVWIYA
AISSIIVFCIGLGIYFHVQRRRRLRNDRDDYDFEMIEDEDEAKAMNGSSRRRGGELYNAF
AGESEEEPLFSDEDDDEPYRDQTTGAELRTSADDTRRND

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kexin like processing protease (Putative uncharacterized protein) contains a PF00082 domain.

Kexin like processing protease (Putative uncharacterized protein) contains a PF01483 domain.

Kexin like processing protease (Putative uncharacterized protein) is proteolytically cut by kexin (S08.070) cleavage. LVKR-TPPP.