Casein alpha s1 (Casein alpha s1, isoform CRA_b)

UniProt : A1A510, P47710, UniProt ID: A1A510_HUMAN, CASA1_HUMAN,

Casein alpha s1 (Casein alpha s1, isoform CRA_b)

Homo sapiens

MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQ
TDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQ
EQIRRMNENSHVQVPFQQLNQLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNN
VMLQW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Casein alpha s1 (Casein alpha s1, isoform CRA_b) is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..