Cytoplasmic dynein intermediate chain (Fragment)

UniProt : Q98SV2, UniProt ID: Q98SV2_XENLA,

Cytoplasmic dynein intermediate chain (Fragment)

Xenopus laevis

EKKKKETDQKKDAVPTQEESDLEKKRREADALLQSMGITSEPPMVPPPTSPSSKSVSTPS
EAGSQDSGDGAGGASARTAVTTKTLHWDTDPSVLQLHSDSDMGRGPMKLGMSKVTQVDFA
PRETVSYTKETQTPILAQNNEGDEDEEETVAPKAVTVQEEDKPEKKEENTEAPPHELTEE
EKQQILHSEEFVSFFDHSTRILERALSEQINIFFDYSGRDLEEKEGEIQAGAKLSFNRQF
FDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPEYVFHC
QSAVMSAAFARFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVG
TQNAHNLISISTDGKICSWSLDMLSQPQDSMELVHKQSKAVAVTCMSFPVGDVNNFVVGS
EEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHSAVGAVDFSHLFITSSFDWTVKLWTT
KNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTASITVDGNP
ALNRVRWTHSGREIAVGNSEGEIFIYDVGEQTAVPRSDEWTRFARTLAEINANRADAEEE
AANRIPG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cytoplasmic dynein intermediate chain (Fragment) contains a PF00400 domain.

Cytoplasmic dynein intermediate chain (Fragment) contains a PF00400 domain.

Cytoplasmic dynein intermediate chain (Fragment) contains a PF00400 domain.

Cytoplasmic dynein intermediate chain (Fragment) is proteolytically cut by caspase-3 (C14.003) cleavage. DSGD-GAGG.