Micronemal protein 6

UniProt : Q9XYH7, UniProt ID: MIC6_TOXGO,

Micronemal protein 6

Toxoplasma gondii

MRLFRCCAAAVVAAESLLWLKNGSPFFAFLPGNGEIADNCSGNPCGGTAAGTCINTPSGY
DCRCEPGYVLGVENDQVTCMMPSGVPMANFVQLSETPAACSSNPCGPEAAGTCKETNSGY
ICRCNQGYRISLDGTGNVTCIVRQESGCEENGCGPPDAVQSCRRLTGTAGRLCVCKENFI
ATIDASAHITCKRVPPHYRKPPFEFGKGGHPVDSEPSKRQREDEGESREPESDSTEPGRD
QERRTPLEESQEPEGSTPDSQQSRGGSGSDSTESEEQGKEREEGSGHAGAIAGGVIGGLL
LLSAAGAGVAYMRKSGSGGGEEIEYERGIEAAEASEVEVLVDLDSKTWD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Micronemal protein 6 is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Micronemal protein 6 is proteolytically cut by aarA protein (S54.004) cleavage..

Micronemal protein 6 is proteolytically cut by RHBDL2 g.p. (S54.002) cleavage..

Micronemal protein 6 is proteolytically cut by aarA protein (S54.004) cleavage..

Micronemal protein 6 is proteolytically cut by Rhomboid-1 (S54.001) cleavage..