Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a)

UniProt : B0ZBE2, P01019, UniProt ID: ANGT_HUMAN, B0ZBE2_HUMAN,

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a)

Homo sapiens

MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) contains a PF00079 domain.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. YIHP-FHLV.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by angiotensin-converting enzyme 2 (M02.006) cleavage. YIHP-FHLV.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by angiotensin-converting enzyme 2 (M02.006) cleavage. HPFH-LVIH.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by chymase (S01.140) cleavage. IHPF-HLVI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by cathepsin G (S01.133) cleavage. IHPF-HLVI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (XM02-001) cleavage. IHPF-HL--.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by tripeptidyl-peptidase I (S53.003) cleavage. -RVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by sedolisin (S53.001) cleavage. DRVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by lysosomal Pro-Xaa carboxypeptidase (S28.001) cleavage. YIHP-F---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. YIHP-F---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by trepolisin (S08.024) cleavage. IHPF-HL--.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by tonin (S01.172) cleavage. IHPF-HLVI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by tonin (S01.172) cleavage. IHPF-HLVI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by dipeptidyl-peptidase III (M49.001) cleavage. --RV-YIHP.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by dipeptidyl-peptidase III (M49.001) cleavage. --YI-HPF-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by dipeptidyl-peptidase III (M49.001) cleavage. --DR-VYIH.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aspartyl aminopeptidase (M18.002) cleavage. ---D-RVYI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by carboxypeptidase A3 (M14.010) cleavage. HPFH-L---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M12.306) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M12.303) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M12.183) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M12.182) cleavage. HPFH-L---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by ruberlysin (M12.150) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by ruberlysin (M12.150) cleavage. VYIH-PFHL.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by bothrolysin (M12.139) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M12.137) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M9G.026) cleavage. ARVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (M9E.004) cleavage. YIHP-F---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by vimelysin (M04.010) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by vimelysin (M04.010) cleavage. ARVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by coccolysin (M04.007) cleavage. ARVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by coccolysin (M04.007) cleavage. YIHP-FHL-.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by coccolysin (M04.007) cleavage. DRVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aminopeptidase PILS (M01.018) cleavage. ---V-YIHP.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aminopeptidase PILS (M01.018) cleavage. ---R-VYIH.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aminopeptidase PILS (M01.018) cleavage. ---D-RVYI.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by cystinyl aminopeptidase (M01.011) cleavage. ---V-YIHP.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by cystinyl aminopeptidase (M01.011) cleavage. ---R-VYIH.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by scytalidoglutamic peptidase (G01.001) cleavage. VYIH-PFHL.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (A9G.010) cleavage. ARVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by (A9G.010) cleavage. HPFH-L---.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aspergillopepsin I (A01.016) cleavage. VYIH-PFHL.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by aspergillopepsin I (A01.016) cleavage. ARVY-IHPF.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by renin (A01.007) cleavage. PFHL-VIHN.

Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8) (Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8), isoform CRA_a) is proteolytically cut by chymase (S01.140) cleavage. DRVY-IHPF.