Plasmodium falciparum 3D7

MRKLYCVLLLSAFEFTYMINFGRGQNYWEHPYQNSDVYRPINEHREHPKEYEYPLHQEHT
YQQEDSGEDENTLQHAYPIDHEGAEPAPQEQNLFSSIEIVERSNYMGNPWTEYMAKYDIE
EVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQYLKDGG
FAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVY
DDKDKKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEK
VCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDY
EKIKEGFKNKNASMIKSAFLPTGAFKADRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLI
NNSSYIATTALSHPIEVENNFPCSLYKDEIMKEIERESKRIKLNDNDDEGNKKIIAPRIF
ISDDKDSLKCPCDPEMVSNSTCRFFVCKCVERRAEVTSNNEVVVKEEYKDEYADIPEHKP
TYDKMKIIIASSAAVAVLATILMVYLYKRKGNAEKYDKMDEPQDYGKSNSRNDEMLDPEA
SFWGEEKRASHTTPVLMEKPYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by subtilisin-like protease 2 (S08.013) cleavage. RIKL-NDND.

is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

is proteolytically cut by rhomboid peptidase TgROM5 (S54.023) cleavage..

is proteolytically cut by subtilisin-like protease 2 (S08.013) cleavage. AEVT-SNNE.

is proteolytically cut by subtilisin-like protease 2 (S08.013) cleavage. RIKL-NDND.

is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

is proteolytically cut by rhomboid peptidase TgROM5 (S54.023) cleavage..

is proteolytically cut by subtilisin-like protease 2 (S08.013) cleavage. AEVT-SNNE.

is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..