Tachykinin-3

UniProt : Q9UHF0, UniProt ID: TKNK_HUMAN,

Tachykinin-3

Homo sapiens

MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGL
LKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRA
E

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tachykinin-3 contains a PF03823 domain.

Tachykinin-3 is proteolytically cut by aminopeptidase A (M01.003) cleavage. ---M-RIML.