Isoform 1 of Kallikrein-11
|
UniProt : Q0WXX5, Q9UBX7, UniProt ID: Q0WXX5_HUMAN, Q9UBX7-1, Isoform 1 of Kallikrein-11 Homo sapiens MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTA AHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPV SITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPG NITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYV DWIQETMKNN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 1 of Kallikrein-11 contains a PF00089 domain.
Isoform 1 of Kallikrein-11 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. PQLR-LPHT.
Isoform 1 of Kallikrein-11 is proteolytically cut by plasmin (S01.233) cleavage. PQLR-LPHT.
Isoform 1 of Kallikrein-11 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. PQLR-LPHT.
Isoform 1 of Kallikrein-11 is proteolytically cut by plasmin (S01.233) cleavage. PQLR-LPHT.
Isoform 1 of Kallikrein-11 is proteolytically cut by () cleavage. GETR-IIKG.