Streptogrisin-B

UniProt : P00777, UniProt ID: PRTB_STRGR,

Streptogrisin-B

Streptomyces griseus

MRIKRTSNRSNAARRVRTTAVLAGLAAVAALAVPTANAETPRTFSANQLTAASDAVLGAD
IAGTAWNIDPQSKRLVVTVDSTVSKAEINQIKKSAGANADALRIERTPGKFTKLISGGDA
IYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGI
VRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVV
YGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Streptogrisin-B contains a PF00089 domain.

Streptogrisin-B contains a PF02983 domain.

Streptogrisin-B is proteolytically cut by streptogrisin B (S01.262) cleavage. FTKL-ISGG.