Putative uncharacterized protein

UniProt : B2RDA1, UniProt ID: B2RDA1_HUMAN,

Putative uncharacterized protein

Homo sapiens

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTL
PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVT
DFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHME
SEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDES
NEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00865 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. VAQD-LNAP.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. VVYG-LRSK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VVYG-LRSK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VAQD-LNAP.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LNGA-YKAI.